Host taxon 10090
Protein NP_001294953.1
cutA divalent cation tolerance homolog-like isoform 2
Mus musculus
Gene Cutal, UniProt Q9D1U5
>NP_001294953.1|Yersinia pseudotuberculosis IP 32953|cutA divalent cation tolerance homolog-like isoform 2
MDRPESRCPPPGSLRLVLTCLLILTAVLMYPVLRTFSLWLHSSLTGIYVSGSYSIVFVNCPNEQIARDIARAILDKKMASSVNILPKTSSLYFWKGEIEEGIEVSLVGASF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.37 | -1.36696139136441 | 0.046 | 28096329 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)