Host taxon 10090
Protein NP_001128169.1
cortexin-3
Mus musculus
Gene Ctxn3, UniProt Q8BXZ0
>NP_001128169.1|Yersinia pseudotuberculosis IP 32953|cortexin-3
MDGGQPVPSPLVPLGNGSDYSMSLEQKTTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEGLEKGQFDHALA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.16 | -2.15915565132047 | 0.022 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)