Host taxon 10090
Protein NP_112150.1
complement C1q tumor necrosis factor-related protein 3 isoform 2 precursor
Mus musculus
Gene C1qtnf3, UniProt Q9ES30
>NP_112150.1|Yersinia pseudotuberculosis IP 32953|complement C1q tumor necrosis factor-related protein 3 isoform 2 precursor
MLGRQRIWWHLLPLLFLPFCLCQDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.66 | -2.663691007615 | 0.00016 | 28096329 | |
Retrieved 1 of 3 entries in 1 ms
(Link to these results)