Host taxon 10090
Protein NP_001191058.1
complement C1q tumor necrosis factor-related protein 1 precursor
Mus musculus
Gene C1qtnf1, UniProt Q9QXP7
>NP_001191058.1|Yersinia pseudotuberculosis IP 32953|complement C1q tumor necrosis factor-related protein 1 precursor
MGSCAQGFMLGCCLLLAITWGPILSLVPRVQEEQQEWEETEELPSPLDPVTRPEETREKYSPRQGEDLPTSRCYRCCDPSTPVYQTIPPPQINITILKGEKGDRGDRGLQGKYGKIGSTGPRGHVGPKGQKGSIGAPGNHCKSQYAAFSVGRKKALHSNDYFQPVVFDTEFVNLYKHFNMFTGKFYCYVPGIYFFSLNVHTWNQKETYLHIMKNEEEVVILYAQVSDRSIMQSQSLMMELREEDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKPASEP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.04 | 1.04233158098422 | 3.9e-5 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)