Host taxon 10090
Protein NP_848714.1
COMM domain-containing protein 8 isoform a
Mus musculus
Gene Commd8, UniProt Q9CZG3
>NP_848714.1|Yersinia pseudotuberculosis IP 32953|COMM domain-containing protein 8 isoform a
MEPEEGTPLWRLQKLPPEQGAGLLHKIIDGFCGRAYPAHQDYHSVWNSAEWKHVLEDVTTFFKAVVGKNFSEEETLQQLNQLNSCHQEAVLKCLKSRRNEIKQALLGEIVDISCAQLQDFDWQLKLALSSDKIATLQMPLLNLHLDVKEDDKVKPYTVEMSKEELQSLISSLEAANKVVLQLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.57 | 0.567606592938239 | 0.03 | 28096329 | |
Retrieved 1 of 2 entries in 1.7 ms
(Link to these results)