Bacterial taxon 273123
Protein WP_002211350.1
cold shock-like protein CspD
Yersinia pseudotuberculosis IP 32953
Gene cspD, UniProt Q66CL1
>WP_002211350.1|Yersinia pseudotuberculosis IP 32953|cold shock-like protein CspD
METGTVKWFNNAKGFGFICPEGGGEDIFAHYSTIQMDGYRTLKAGQIVNFDVHEGPKGNHASLIVPLELNSVPPLDGVSPPELAILA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●●○ -3.87 | -3.86775622371468 | 6.2e-46 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.39 | -2.3882815204099 | 1.7e-16 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ 2.04 | 2.04277245177574 | 1.2e-9 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.85 | 0.847946566120743 | 0.023 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
Retrieved 4 of 1 entries in 1.3 ms
(Link to these results)