Host taxon 10090
Protein NP_001298041.1
coiled-coil domain-containing protein 126 isoform 2 precursor
Mus musculus
Gene Ccdc126, UniProt Q8BIS8
>NP_001298041.1|Yersinia pseudotuberculosis IP 32953|coiled-coil domain-containing protein 126 isoform 2 precursor
MFRTISRKNMSQKLSFLLLVFGLIWGLMLLHYTLQQPRRQSSVKLREQILDLSKRYVKALAEESRSTADVDSGASMAGYVLHLPGPASLYLLSNSASQEMTHC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.74 | 0.735433191014771 | 0.045 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)