Host taxon 10090
Protein NP_954691.3
CMRF35-like molecule 7 isoform 1 precursor
Mus musculus
Gene Cd300lb, UniProt Q3U497
>NP_954691.3|Yersinia pseudotuberculosis IP 32953|CMRF35-like molecule 7 isoform 1 precursor
MWLSPALLLLSFPGCLSIQGPALVRGPEQGSVTVQCRYSSRWQTNKKWWCRGASWSTCRVLIRSTGSEKETKSGRLSIRDNQKNHSFQVTMEMLRQNDTDTYWCGIEKFGTDRGTRVKVNVYSVGKDTMSTSNQLPWPTVDGSTDMVSSDLQKRTYYMLLVFVKVPALLILVGAVLWLKRSTQKVPEEQWRHTLCSDLDSELLAKDISP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.19 | 2.19177095787079 | 4.2e-7 | 28096329 | |
Retrieved 1 of 3 entries in 1.1 ms
(Link to these results)