Host taxon 10090
Protein NP_065250.1
claudin-13
Mus musculus
Gene Cldn13, UniProt Q9Z0S4
>NP_065250.1|Yersinia pseudotuberculosis IP 32953|claudin-13
MVVSKQEAISFSVTSLGWVGAIVSCVLPVWRVTFPDDETDPDATIWEGLWHICQVRENRWIQCTLYDTRILVAQDIKVSRVFMVICTIGTWLGLLLCVLGDWRINCFMNFTIEENLLKVAGGMFLSVGLLMLVPLSWVTHNIIHGFFNPLLGFSKKVQMGSSLSLAWTSSLLLLLGGILLCVNIPVCRDFPRCIETPSARPSGANNDTLDV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.62 | -2.62195909857165 | 0.0013 | 28096329 | |
Retrieved 1 of 2 entries in 1.3 ms
(Link to these results)