Host taxon 10090
Protein NP_705810.2
CKLF-like MARVEL transmembrane domain-containing protein 4
Mus musculus
Gene Cmtm4, UniProt Q8CJ61
>NP_705810.2|Yersinia pseudotuberculosis IP 32953|CKLF-like MARVEL transmembrane domain-containing protein 4
MRGGEELDGFEGEASSTSMISGASSPYQPTTEPVSQRRGLAGLRCDPDYLRGALGRLKVAQVILALIAFICIETIMECSPCEGLYFFEFVSCSAFVVTGVLLILFSLNLHMRIPQINWNLTDLVNTGLSTFFFFIASIVLAALNHKTGAEIAAVIFGFLATAAYAVSTFLAMQKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.92 | -0.916668272107818 | 1.8e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.5 ms
(Link to these results)