Host taxon 10090
Protein NP_031650.3
chromobox protein homolog 3
Mus musculus
Gene Cbx3, UniProt Q9DCC5
>NP_031650.3|Yersinia pseudotuberculosis IP 32953|chromobox protein homolog 3
MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.2 | 1.19670494709128 | 0.026 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)