Host taxon 10090
Protein NP_080059.2
charged multivesicular body protein 3 isoform 1
Mus musculus
Gene Chmp3, UniProt Q9CQ10
>NP_080059.2|Yersinia pseudotuberculosis IP 32953|charged multivesicular body protein 3 isoform 1
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKEVCVVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEAAEMEIDRILFEITAGALGKAPSKVTDALPEPEPAGAMAASEEGEEEEDEEDLEAMQSRLATLRS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.78 | 0.778059397898184 | 0.028 | 28096329 | |
Retrieved 1 of 1 entries in 1.9 ms
(Link to these results)