Host taxon 10090
Protein NP_663581.1
charged multivesicular body protein 1a
Mus musculus
Gene Chmp1a, UniProt Q921W0
>NP_663581.1|Yersinia pseudotuberculosis IP 32953|charged multivesicular body protein 1a
MDDTLFQLKFTAKQLEKLAKKAEKDSKAEQAKVKKALQQKNVECARVYAENAIRKKNEGVNWLRMASRVDAVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQKVSAVMDRFEQQVQNLDVHTSVMEDSVSSATTLTTPQEQVDSLIVQIAEENGLEVLDQLSQLPEGASAVGESSVRSQEDQLSRRLAALRN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.83 | -0.83114101482842 | 0.028 | 28096329 | |
Retrieved 1 of 1 entries in 0.9 ms
(Link to these results)