Host taxon 10090
Protein NP_848762.1
CGG triplet repeat-binding protein 1
Mus musculus
Gene Cggbp1, UniProt Q8BHG9
>NP_848762.1|Yersinia pseudotuberculosis IP 32953|CGG triplet repeat-binding protein 1
MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSPAQTEKASVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRAYLPDGYENENQLLSSQDC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.6 | 0.595797761892557 | 0.0056 | 28096329 | |
Retrieved 1 of 1 entries in 2 ms
(Link to these results)