Host taxon 10090
Protein NP_082724.1
centromere protein V
Mus musculus
Gene Cenpv, UniProt Q9CXS4
>NP_082724.1|Yersinia pseudotuberculosis IP 32953|centromere protein V
MRRTRSAVATGPREQRRSGATGGLSGGESRAQRSRSRTRAGAGGGGGAVGPQPSAKPRPKPPPRAQEAAAEEPPPAVTPAASVSALDLGEQRERWETFQKRQRLSFEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKKQNRHFIVPASRFKLLKGAESITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHCLDEGTVRSVVTEEFNGSDWERAMKEHKTIKNMSKE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.64 | -1.64248499375933 | 6.1e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)