Host taxon 10090
Protein NP_001153402.1
centromere protein L
Mus musculus
Gene Cenpl, UniProt Q14A61
>NP_001153402.1|Yersinia pseudotuberculosis IP 32953|centromere protein L
MDSCDFRGLTSRRRTSNLKNYFVGATPLQKRLELVRRQNSDFPSPSRRKIPQCSQLQEDIDPQKVAFLLHKQWTIYSLTPLYKFSYSNLKDYSRLLSAFIVAEKQKGVAVEVGEDFNIKVIFSTLLGVKGTQRDHEAFLVQILSKSQSSREHREDKVLWTGWFCCVFGESLQETVSEDFTCLPLFLANGAESNTSLIRDWFQKTFDCCFSPLAISAFNLSWMAAMWTACKMDRYMATTEFLWSVPCSPQSLDISYAIHPEDAKALWESVHKTPGEVTQEEVDLFMNCLYSHFHRHFKIHLAATRLVRVSTSVASAHTDGKIKILCHKYLIGVLAYMTELAIFQIE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.95 | 0.95355662818157 | 0.044 | 28096329 | |
Retrieved 1 of 1 entries in 1.2 ms
(Link to these results)