Host taxon 10090
Protein NP_079946.2
cell death-inducing p53-target protein 1 isoform 4
Mus musculus
Gene Cdip1, UniProt Q9DB75
>NP_079946.2|Yersinia pseudotuberculosis IP 32953|cell death-inducing p53-target protein 1 isoform 4
MSNEPPPPYPGGPTAPLLEEKSGAPLTPGRTSPAVMQPPPGMPLPSADIAPPPYEPPGQPVPQPGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGPYPGPGGHTATVLVPSGAATTVTVLQGEIFEGAPVQTVCPHCQQAITTKISYEIGLMNFVLGFFCCFMGCDLGCCLIPCLINDFKDVTHTCPSCKAYICTYKRLC
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.73 | -0.731884610880506 | 0.00076 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)