Host taxon 10090
Protein NP_598768.1
CDGSH iron-sulfur domain-containing protein 1
Mus musculus
Gene Cisd1, UniProt Q91WS0
>NP_598768.1|Yersinia pseudotuberculosis IP 32953|CDGSH iron-sulfur domain-containing protein 1
MGLSSNSAVRVEWIAAVTFAAGTAALGYLAYKKFYAKENRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.81 | -0.813948925117127 | 0.0014 | 28096329 | |
Retrieved 1 of 1 entries in 1.3 ms
(Link to these results)