Host taxon 10090
Protein NP_848741.1
CDC42 small effector protein 2
Mus musculus
Gene Cdc42se2, UniProt Q8BGH7
>NP_848741.1|Yersinia pseudotuberculosis IP 32953|CDC42 small effector protein 2
MSEFWLCFNCCIAEQPQPKRRRRIDRSMIGEPTNFVHTAHVGSGDLFSGMNSVSSIQNQMQSKGGYGGGMPANVQMQLVDTKAG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.72 | -0.71892736766788 | 5.5e-8 | 28096329 | |
Retrieved 1 of 1 entries in 1.7 ms
(Link to these results)