Host taxon 10090
Protein NP_033986.1
CD83 antigen isoform 1 precursor
Mus musculus
Gene Cd83, UniProt O88324
>NP_033986.1|Yersinia pseudotuberculosis IP 32953|CD83 antigen isoform 1 precursor
MSQGLQLLFLGCACSLAPAMAMREVTVACSETADLPCTAPWDPQLSYAVSWAKVSESGTESVELPESKQNSSFEAPRRRAYSLTIQNTTICSSGTYRCALQELGGQRNLSGTVVLKVTGCPKEATESTFRKYRAEAVLLFSLVVFYLTLIIFTCKFARLQSIFPDISKPGTEQAFLPVTSPSKHLGPVTLPKTETV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.86 | -0.864049392209965 | 0.00027 | 28096329 | |
Retrieved 1 of 1 entries in 1.6 ms
(Link to these results)