Host taxon 10090
Protein NP_001156968.1
CD160 antigen isoform a precursor
Mus musculus
Gene Cd160, UniProt O88875
>NP_001156968.1|Yersinia pseudotuberculosis IP 32953|CD160 antigen isoform a precursor
MQRILMAPGQSCCALAILLAIVNFQHGGCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWNCSPETNLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHTEIRQRQRSHPDFSHINGTLSSGFLQVKAWGMLVTSLVALQALYTL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.67 | -1.67024582875278 | 2.2e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)