Host taxon 10090
Protein NP_997014.1
CCAAT/enhancer-binding protein epsilon
Mus musculus
Gene Cebpe, UniProt Q6PZD9
>NP_997014.1|Yersinia pseudotuberculosis IP 32953|CCAAT/enhancer-binding protein epsilon
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAMKPTPEARSLKGPGAPSFPHYLPADPRPFAYPSHTFGPDRKALGPGIYSNPGSYDPRAVAVKEEPRGPEGNRGTSRGSYNPLQYQVAHCGQTAVHLPPTLAAPGQPLRVLKAPVAAAAPPCSPLLKAPSPAGPSHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMAENERLRNRVDQLTQELDTLRNLFRQIPEAASLIKGVGGCS
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.13 | -1.13066200077138 | 0.018 | 28096329 | |
Retrieved 1 of 1 entries in 0.6 ms
(Link to these results)