Host taxon 10090
Protein NP_081014.1
caspase recruitment domain-containing protein 19
Mus musculus
Gene Card19, UniProt Q9D1I2
>NP_081014.1|Yersinia pseudotuberculosis IP 32953|caspase recruitment domain-containing protein 19
MTDQTYCDRLVQDTPFLTGQGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQQRGERHCQEFYRALYIHAQPLHSHLPSRYSPQNSDCRELDWGIESRELSDRGPMSFLAGLGLAAGLALLLYCCPPDPKVLPGTRRVLAFSPVIIDRHVSRYLLAFLADDLGGL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ 0.91 | 0.906514673999817 | 0.00036 | 28096329 | |
Retrieved 1 of 2 entries in 0.9 ms
(Link to these results)