Host taxon 10090
Protein NP_612177.1
calmodulin-like protein 4 isoform a
Mus musculus
Gene Calml4, UniProt Q91WQ9
>NP_612177.1|Yersinia pseudotuberculosis IP 32953|calmodulin-like protein 4 isoform a
MAKFLSQDQINEYKECFSLYDKQQRGKIKATDLLVSMRCLGASPTPGEVQRHLQTHGIDKNGELDFSTFLTIMHMQIKQEDPKKEILLAMLMADKEKKGYIMASELRSKLMKLGEKLTHKEVDDLFKEAGIEPNGQVKYDTFIQRITIPVRDY
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.88 | -0.879896656295586 | 0.0035 | 28096329 | |
Retrieved 1 of 3 entries in 8.4 ms
(Link to these results)