Host taxon 10090
Protein NP_001280573.1
calcium uniporter regulatory subunit MCUb, mitochondrial isoform 2
Mus musculus
Gene Mcub, UniProt Q810S1
>NP_001280573.1|Yersinia pseudotuberculosis IP 32953|calcium uniporter regulatory subunit MCUb, mitochondrial isoform 2
MPGALSGRRMLPSGLCLGRWQLLRTIRARGRGDPRELPSTPQVLCMKLYGNPKYHQALHYGTVEPQDEITVTYKHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIITADGSEIPASTLMDTLLMTDFKLIINKLRYDIRCHKKGQSCNRSPVGSQHQWSPVGRLSSALRAGRGAGLAYLVGVLLGYHGASYLLPVVCEFHRLFCILHHNPAELHILIPPEQAVSSVLPQEIAAAVF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.52 | 2.52178180415319 | 1.2e-5 | 28096329 | |
Retrieved 1 of 2 entries in 1 ms
(Link to these results)