Host taxon 10090
Protein NP_001278204.1
calcium and integrin-binding protein 1 isoform 2
Mus musculus
Gene Cib1, UniProt Q9Z0F4
>NP_001278204.1|Yersinia pseudotuberculosis IP 32953|calcium and integrin-binding protein 1 isoform 2
MGGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEQRTVEESLHTRVSFEQILSLPELKERICMVFSTSPTRDSLSFEDFLDLLSVFSDTATPDIKSHYAFRIFDFDDDGTLDREDLSQLVNCLTGEGEDTRLSASEMKQLIDNILEESDIDRDGTINLSEFQHVISRSPDFASSFKIVL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.64 | -0.639242968670816 | 0.0011 | 28096329 | |
Retrieved 1 of 3 entries in 1.8 ms
(Link to these results)