Host taxon 10090
Protein NP_032625.2
C-X-C motif chemokine 9 precursor
Mus musculus
Gene Cxcl9, UniProt P18340
>NP_032625.2|Yersinia pseudotuberculosis IP 32953|C-X-C motif chemokine 9 precursor
MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.7 | 2.70312400182285 | 2.8e-46 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)