Host taxon 10090
Protein NP_067249.1
C-X-C motif chemokine 10 precursor
Mus musculus
Gene Cxcl10, UniProt P17515
>NP_067249.1|Yersinia pseudotuberculosis IP 32953|C-X-C motif chemokine 10 precursor
MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.22 | 2.21773819137926 | 1.3e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)