Host taxon 10090
Protein NP_001177249.1
C-type lectin domain family 6 member A isoform 2
Mus musculus
Gene Clec4n, UniProt Q3U3M9
>NP_001177249.1|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 6 member A isoform 2
MVQERQSQVTYQFIMDQPSRRLYELHTYHSSLTCFSEGTMVSEKMWGCCPNHWKSFGSSCYLISTKENFWSTSEQNCVQMGAHLVVINTEAEQNFITQQLNESLSYFLGLSDPQGNGKWQWIDDTPFSQNVRFWHPHEPNLPEERCVSIVYWNPSKWGWNDVFCDSKHNSICEMKKIYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.69 | 1.68680688858724 | 1.1e-6 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)