Host taxon 10090
Protein NP_001033693.1
C-type lectin domain family 5 member A isoform 1
Mus musculus
Gene Clec5a, UniProt Q9R007
>NP_001033693.1|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 5 member A isoform 1
MNWHMIISGLIVVVIKVVGMTFFLLYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.32 | 2.31506393128834 | 7.1e-9 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)