Host taxon 10090
Protein NP_001004159.1
C-type lectin domain family 4, member b2
Mus musculus
Gene Clec4b2, UniProt Q67DU8
>NP_001004159.1|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 4, member b2
MMQERPAQGQVVCWSLRLWMAALISILLLSTCFIASCVVTYQLMMNKPNRRLSELHTYHSNLICFSEGTTVSEKVWSCCPKDWKPFGSYCYFTSTDSRASQNKSEEKCSLRGAHLVVIHSQEEQDFITRMLDTAAGYFIGLSDVGNSQWRWIDQTPYNDRATFWHKGEPNNDYEKCVILNYRKTMWGWNDIDCSDEENSVCQMKKIYL
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.63 | -2.63227333822772 | 0.021 | 28096329 | |
Retrieved 1 of 1 entries in 0.7 ms
(Link to these results)