Host taxon 10090
Protein NP_064332.1
C-type lectin domain family 4 member E
Mus musculus
Gene Clec4e, UniProt Q9R0Q8
>NP_064332.1|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 4 member E
MNSTKSPASHHTERGCFKNSQVLSWTIAGASILFLSGCFITRCVVTYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●● 6.73 | 6.73415301717559 | 2.1e-35 | 28096329 | |
Retrieved 1 of 2 entries in 1.2 ms
(Link to these results)