Host taxon 10090
Protein NP_444395.2
C-type lectin domain family 2 member H
Mus musculus
Gene Clec2h, UniProt Q8C1T8
>NP_444395.2|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 2 member H
MNAAKVETSSMGMLQRADLTAADCLQEGEMGKKIQGKCFRIISTVSPVKLYCCYGVIMVLTVAVIALSVALSVRNKIPAMEDREPCYTACPSGWIGFGSKCFYFSEDMGNWTFSQSSCVASNSHLALFHSLEELNFLKRYKGTSDHWIGLHRASTQHPWIWTDNTEYSNLVLTRGGGECGFLSDNGISSGRSYTHRKWICSKFVSSCKSRVGSVPRHV
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.59 | -1.59298766553639 | 1.4e-22 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)