Host taxon 10090
Protein NP_705726.3
C-type lectin domain family 2 member E
Mus musculus
Gene Clec2e, UniProt H7BWZ4
>NP_705726.3|Yersinia pseudotuberculosis IP 32953|C-type lectin domain family 2 member E
MSAAKVEEASMGMLKTDLTAPDCLQEGEMGKKLQAKCLGIISAASCVKLYCCYGVIMVLTVAVVALSVTLSVRKKKPVMESCEPCYAVCSSGWIGFGNKCFYFSEDMGNWTFSQSSCIALDAHLALFDSLEELNFLKRYKGASDHWIGLHRESSEHPWIWTDNTEYNNLVLTRGGGECAYLSNRGIYNSSGDIHKKWICNKPNNYTLQRPLIVNPG
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.12 | -3.12214051188606 | 5.4e-53 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)