Host taxon 10090
Protein NP_064675.1
C-C motif chemokine 28 precursor
Mus musculus
Gene Ccl28, UniProt Q9JIL2
>NP_064675.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 28 precursor
MQQAGLTLMAVAVCVAFQTSEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.51 | -2.50966447764458 | 3.4e-8 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)