Host taxon 10090
Protein NP_033164.1
C-C motif chemokine 25 precursor
Mus musculus
Gene Ccl25, UniProt O35903
>NP_033164.1|Yersinia pseudotuberculosis IP 32953|C-C motif chemokine 25 precursor
MKLWLFACLVACFVGAWMPVVHAQGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAMRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ -2.57 | -2.56574471157348 | 3.6e-24 | 28096329 | |
Retrieved 1 of 3 entries in 0.9 ms
(Link to these results)