Host taxon 10090
Protein NP_081284.2
BTB/POZ domain-containing protein KCTD5
Mus musculus
Gene Kctd5, UniProt Q8VC57
>NP_081284.2|Yersinia pseudotuberculosis IP 32953|BTB/POZ domain-containing protein KCTD5
MAENHCELLPPAPSGLGAGLGGGLCRRCSAGMGALAQRPGGVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAEFYNITSLIKLVKDKIRERDSKISQMPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTTSEPSEKAKILQERGSRM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.64 | -0.636923120162417 | 0.0018 | 28096329 | |
Retrieved 1 of 2 entries in 0.8 ms
(Link to these results)