Host taxon 10090
Protein NP_001276600.1
BTB/POZ domain-containing protein KCTD17 isoform 1
Mus musculus
Gene Kctd17, UniProt E0CYD2
>NP_001276600.1|Yersinia pseudotuberculosis IP 32953|BTB/POZ domain-containing protein KCTD17 isoform 1
MQTTRPAMRMEAGEAAPPVGAGGRPGGGWGKWVRLNVGGTVFLTTRQTLCREQKSFLSRLCQGEELQSDRDETGAYLIDRDPTYFGPILNFLRHGKLVLDKDMAEEGVLEEAEFYNIGPLIRIIKDRMEEKDYTVAQVPPKHVYRVLQCQEEELTQMVSTMSDGWRFEQLVNIGSSYNYGSEDQAEFLCVVSKELHSSPHGLSSESTRKAKPCHLRIPLTFSPSHHRLLLLRFLLEVPVRTLPDPSLSLQ
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.21 | 1.20681857151995 | 0.00011 | 28096329 | |
Retrieved 1 of 2 entries in 0.7 ms
(Link to these results)