Host taxon 10090
Protein NP_080781.1
BMP and activin membrane-bound inhibitor homolog precursor
Mus musculus
Gene Bambi, UniProt Q9D0L6
>NP_080781.1|Yersinia pseudotuberculosis IP 32953|BMP and activin membrane-bound inhibitor homolog precursor
MDRHSSYFFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNTNSPLTHGCLDSLASTADICRAKQAQNHSGPAMPTLECCHEDMCNYRGLHDVLSPSKSEASGQGNRYQHDSSRNLITKMQELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDERQQMLSRLHYSFHGHHSKKGQVAKLDLECMVPVSGQENCCLTCDKMRQAELSNEKILSLVHWGMYSGHGKLEFI
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ -1.26 | -1.25681244696961 | 0.00099 | 28096329 | |
Retrieved 1 of 1 entries in 1.8 ms
(Link to these results)