Host taxon 10090
Protein NP_001139024.1
BLOC-1-related complex subunit 8 isoform 1
Mus musculus
Gene Borcs8, UniProt Q9D6Y4
>NP_001139024.1|Yersinia pseudotuberculosis IP 32953|BLOC-1-related complex subunit 8 isoform 1
MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKSLVDSSVYFRSVEGLLKQAISIRDHMNTSAQGHSQEKLSPPPSLA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.61 | -0.606545158893514 | 0.037 | 28096329 | |
Retrieved 1 of 2 entries in 2 ms
(Link to these results)