Host taxon 10090
Protein NP_001295215.1
bis(5'-adenosyl)-triphosphatase isoform 2
Mus musculus
Gene Fhit, UniProt O89106
>NP_001295215.1|Yersinia pseudotuberculosis IP 32953|bis(5'-adenosyl)-triphosphatase isoform 2
MSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLVCPLRPVERFRDLHPDEVADLFQVTQRVGTVVEKHFQGTSITFSMQDGPEAGQTVKHVHVHVLPRKAGDFPRNDNIYDELQKHDREEEDSPAFWRSEKEMAAEAEALRVYFQA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●●○ -3.11 | -3.10528687415003 | 1.3e-5 | 28096329 | |
Retrieved 1 of 2 entries in 0.6 ms
(Link to these results)