Bacterial taxon 273123
Protein WP_002224024.1
bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
Yersinia pseudotuberculosis IP 32953
Gene ubiE, UniProt Q66FT0
>WP_002224024.1|Yersinia pseudotuberculosis IP 32953|bifunctional demethylmenaquinone methyltransferase/2-methoxy-6-polyprenyl-1,4-benzoquinol methylase UbiE
MVDQEKETTHFGFRTVAKEQKEGMVAEVFHSVAAKYDLMNDLMSFGVHRIWKRFTVDCSGVRRGQRVLDLAGGTGDLTAKFSRLVGEQGEVILADINESMLRMGREKLRDKGIVGNVSYVQANAEALPFPDNYFDCITISFGLRNVTEKEKALRSMFRVLKPGGRLLVLEFSKPLLEPLSKAYDAYSFHILPKIGELVAQDAESYRYLAESIRMHPDQETLKGMMADAGFENVTYSNLTGGIVALHRGFKF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.41 | -2.41190012847263 | 2.8e-13 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●●○○ -2.26 | -2.26329398488513 | 1.4e-22 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.95 | -1.95295432686476 | 6.2e-13 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.92 | -1.91690964076642 | 4.3e-11 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
Retrieved 4 of 1 entries in 0.8 ms
(Link to these results)