Host taxon 10090
Protein NP_061212.3
BET1-like protein
Mus musculus
Gene Bet1l, UniProt O35153
>NP_061212.3|Yersinia pseudotuberculosis IP 32953|BET1-like protein
MADWTRAQSSGAVEDILDRENKRMADSLASKVTRLKSLALDIDRDTEDQNRYLDGMDSDFTSVTGLLTGSVKRFSTMARSGRDNRKLLCGMAVVLIVAFFILSYLLSRTRT
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.99 | -0.985893572891034 | 0.00062 | 28096329 | |
Retrieved 1 of 1 entries in 1 ms
(Link to these results)