Host taxon 10090
Protein NP_033884.1
bcl-2-like protein 11 isoform 3
Mus musculus
Gene Bcl2l11, UniProt O54918
>NP_033884.1|Yersinia pseudotuberculosis IP 32953|bcl-2-like protein 11 isoform 3
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.64 | 1.64006944018621 | 6.2e-19 | 28096329 | |
Retrieved 1 of 5 entries in 0.8 ms
(Link to these results)