Host taxon 10090
Protein NP_083243.1
basic leucine zipper transcriptional factor ATF-like 2 isoform 1
Mus musculus
Gene Batf2, UniProt Q8R1H8
>NP_083243.1|Yersinia pseudotuberculosis IP 32953|basic leucine zipper transcriptional factor ATF-like 2 isoform 1
MQLCGSSELLTETDLGESQKQLKKKQKNRVAAQRSRQKHTSKADALHQQHESLEKQNHALRKEIQALQTELAGWGRTLHLHERLCRVDCDPCPVLLPSGCPIQAKQPSGQPAPLGYNGCQEQLGLFQTPGSSPRAQHLSPGPCSHESPGLLPSLLPSLAFDPLMVRTPLAQLSPSPVLSASSPSGSSLLGSFSKLDPLIPSPQDQLAPPQPLRQEQPTSGRLASSDSPAALGPECSQNREHLPALPGSSTHWQKSSVAPSPQALMAFPLLSSAKVHF
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●○○○ 1.54 | 1.53688067501115 | 8.8e-10 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)