Host taxon 10090
Protein NP_031560.2
B-cell leukemia/lymphoma 2 related protein A1b
Mus musculus
Gene Bcl2a1b, UniProt Q497M6
>NP_031560.2|Yersinia pseudotuberculosis IP 32953|B-cell leukemia/lymphoma 2 related protein A1b
MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESIDTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIINNTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLLK
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●●●○○ 2.06 | 2.06346028480964 | 6.2e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.4 ms
(Link to these results)