Host taxon 10090
Protein NP_001300868.1
B-cell antigen receptor complex-associated protein beta chain isoform 2 precursor
Mus musculus
Gene Cd79b, UniProt P15530
>NP_001300868.1|Yersinia pseudotuberculosis IP 32953|B-cell antigen receptor complex-associated protein beta chain isoform 2 precursor
MATLVLSSMPCHWLLFLLLLFSGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKDGIILIQTLLIILFIIVPIFLLLDKDDGKAGMEEDHTYEGLNIDQTATYEDIVTLRTGEVKWSVGEHPGQE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.98 | -0.984188704530589 | 7.9e-8 | 28096329 | |
Retrieved 1 of 1 entries in 1.1 ms
(Link to these results)