Bacterial taxon 273123
Protein WP_002211349.1
ATP-dependent Clp protease adapter ClpS
Yersinia pseudotuberculosis IP 32953
Gene clpS, UniProt Q66CL0
>WP_002211349.1|Yersinia pseudotuberculosis IP 32953|ATP-dependent Clp protease adapter ClpS
MGKNNDWLNFEHLVKDKQIEALQPPSMYKVILNNDDYTPMEFVIDVLQKFFSYDIERATQLMLNVHYQGKAICGVFTAEVAETKVAHVNQYARENEHPLLCTLEKA
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●●○○○ -1.14 | -1.13530537155242 | 8.4e-6 | 28096329 | Bacterial control measured at early-stationary growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.84 | 0.842014340226719 | 0.00019 | 28096329 | Bacterial control measured at mid-exponential growth phase at 25ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ 0.77 | 0.76845948596808 | 0.0026 | 28096329 | Bacterial control measured at mid-exponential growth phase at 37ºC |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | pathogen | Lymphoid tissue | 3 days | ●○○○○ -0.67 | -0.674174192101882 | 0.018 | 28096329 | Bacterial control measured at early-stationary growth phase at 25ºC |
Retrieved 4 of 1 entries in 1.9 ms
(Link to these results)