Host taxon 10090
Protein NP_079589.2
ATP synthase subunit delta, mitochondrial isoform 1 precursor
Mus musculus
Gene Atp5d, UniProt Q4FK74
>NP_079589.2|Yersinia pseudotuberculosis IP 32953|ATP synthase subunit delta, mitochondrial isoform 1 precursor
MLPASLLRHPGLRRLMLQARTYAEAAAAPAPAAGPGQMSFTFASPTQVFFDSANVKQVDVPTLTGAFGILASHVPTLQVLRPGLVVVHTEDGTTTKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAARANLEKAQSELSGAADEAARAEIQIRIEANEALVKALE
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.63 | -0.630314248797822 | 0.0066 | 28096329 | |
Retrieved 1 of 2 entries in 1.6 ms
(Link to these results)