Host taxon 10090
Protein NP_001288650.1
ATP synthase F(0) complex subunit C3, mitochondrial isoform a precursor
Mus musculus
Gene Atp5g3, UniProt Q14BC2
>NP_001288650.1|Yersinia pseudotuberculosis IP 32953|ATP synthase F(0) complex subunit C3, mitochondrial isoform a precursor
MFACAKLARTPALIRAGSRVAYRPISASVLSRPETRTGEGSTVFNGAQNGVCQLIRREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
| Host |
Host taxon identifier |
Pathogen |
Pathogen taxon identifier |
Organism |
Tissue |
Time Post-Infection |
Log2 Fold Change |
Precise Log2 Fold Change |
p-Value |
Reference |
Note |
| Mouse (Mus musculus) | 10090 | Yersinia pseudotuberculosis IP 32953 | 273123 | infected host | Lymphoid tissue | 3 days | ●○○○○ -0.86 | -0.860549008049354 | 5.1e-6 | 28096329 | |
Retrieved 1 of 1 entries in 0.8 ms
(Link to these results)